| Basic Information | |
|---|---|
| Taxon OID | 3300005200 Open in IMG/M |
| Scaffold ID | Ga0072940_1176679 Open in IMG/M |
| Source Dataset Name | Nasutitermes gut metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 934 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Murphy's Creek, Queensland, Australia | |||||||
| Coordinates | Lat. (o) | -27.45 | Long. (o) | 152.04 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001172 | Metagenome | 757 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072940_11766791 | F001172 | N/A | HHQFNIQQLYALSTLYLCVLYLSENKQRLVPLQHKLIGFYNRDKKCLQRGTGWVLK* |
| ⦗Top⦘ |