Scaffold Ga0072940_1090567

Overview

Basic Information

• Taxon OID: 3300005200
• Scaffold ID: Ga0072940_1090567
• Source Dataset Name: Nasutitermes gut metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2226
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: Murphy's Creek, Queensland, Australia
• Coordinates
  • Lat. (^o): -27.45
  • Long. (^o): 152.04

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004931	Metagenome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072940_10905677	F004931	N/A	RRPIGRPKTCWVDDIRKDMQKLKVPNWKTLAQDRRRWKELSEKAKTL*