NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073159_1004182

Scaffold Ga0073159_1004182


Overview

Basic Information
Taxon OID3300005192 Open in IMG/M
Scaffold IDGa0073159_1004182 Open in IMG/M
Source Dataset NameE5 T9
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Alicante
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1183
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → Halorubrum aethiopicum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E5

Source Dataset Sampling Location
Location NameSalinas de Campos (Mallorca)
CoordinatesLat. (o)39.338015Long. (o)3.051796Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066493Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0073159_10041821F066493GAGGMSEREWHDGVVDVADELVQEHSAEGAIERLQTRRKTSSDELQARCTEAIAYIRREVQADE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.