| Basic Information | |
|---|---|
| Taxon OID | 3300005183 Open in IMG/M |
| Scaffold ID | Ga0068993_10261808 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 617 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Francisco Bay, California | |||||||
| Coordinates | Lat. (o) | 38.045666 | Long. (o) | -121.866516 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027688 | Metagenome | 194 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068993_102618082 | F027688 | N/A | GPDRRFLLLVEMFPTWAKPPRVRQAGMLMRGVDTTGNFDDEPRPDAEWSEAAVANWAAVVNRRARLIFEDSKVAPSEAYGGTRPAT* |
| ⦗Top⦘ |