Scaffold Ga0069000_10000508

Overview

Basic Information

• Taxon OID: 3300005182
• Scaffold ID: Ga0069000_10000508
• Source Dataset Name: Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3800
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location

• Location Name: USA: San Francisco Bay, California
• Coordinates
  • Lat. (^o): 38.15012
  • Long. (^o): -122.438774

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011939	Metagenome / Metatranscriptome	285	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069000_100005086	F011939	AGGA	MPEMTVELIEETLRKEVRKIDKSVQVVAVEPSKKENFYRVTLLKDRKFGSAELKKDVIEQYLSQEGKGKGLRRALGKAVSHLSIKYKR*