NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066683_10205626

Scaffold Ga0066683_10205626


Overview

Basic Information
Taxon OID3300005172 Open in IMG/M
Scaffold IDGa0066683_10205626 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1216
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002496Metagenome / Metatranscriptome554Y
F028633Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0066683_102056261F028633GAGVNTPPGQETVNHVAPNGTVESAIRSLPFPGHPEIYSKKDVEKEKELAEIDFYNGKTREGLDIVLIPKTYSTSPGINIHAVTLPAGMSRLSYAEGHTAKSHSSNDKIIAKYKQTIPTHFTYSPSI
Ga0066683_102056262F002496N/ASMVKSGSSKVVLPDGKLVFGSLAQNPRGENSSPEDYWTRDAIRGHSFYKVLSSKAPVANILNLNDAKCLQDVALAQDMTRGVILDSIFRQVDRLGNISIAELQHYVTNKGKVKWDHKVSDKDKTEAVSPILPLKRIMYKDNDDGMNWGMNSISVTPILNETHHIDRTIYNRLQWLAGLMQDGEPGSDAKIKDYFVNIVHVSSDNYDKLKASLVKQAESLKNRVDTKDILVDLDFAGTMEKLYATELEAAQAANSAAPASSTPAT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.