Scaffold Ga0071327_1255337

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071327_1255337

Scaffold Ga0071327_1255337

Overview

Basic Information
Taxon OID	3300005170 Open in IMG/M
Scaffold ID	Ga0071327_1255337 Open in IMG/M
Source Dataset Name	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	837
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Germany: Marburg
Coordinates	Lat. (^o)	50.8	Long. (^o)	8.81	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007210	Metagenome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071327_12553372	F007210	N/A	DGSSQSFGGLTAQIRWFGLRVGGQPTHSLHSSNEPGELSQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.