Scaffold Ga0071327_1004855

Overview

Basic Information

• Taxon OID: 3300005170
• Scaffold ID: Ga0071327_1004855
• Source Dataset Name: Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7058
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (53.85%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Germany: Marburg
• Coordinates
  • Lat. (^o): 50.8
  • Long. (^o): 8.81

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000087	Metagenome	2460	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071327_10048552	F000087	AGG	MDALQLCPDSFHTGVTAEALRAKIDRKSAISLQRGHFNPKFQVEGVAPPPTNHLCMVS*