NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066674_10126875

Scaffold Ga0066674_10126875


Overview

Basic Information
Taxon OID3300005166 Open in IMG/M
Scaffold IDGa0066674_10126875 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1196
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003321Metagenome / Metatranscriptome494Y
F003811Metagenome / Metatranscriptome467Y
F037379Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0066674_101268751F003811GGAGGMAPNITLLDLVNAVAEHARSEAEVIATIVCMVNQGRVRLCGTFKGARFDLTTFTAA*
Ga0066674_101268752F003321AGGAGMSLVPGTRCRSARTIVFLGGIVRRATPGTLVSQRENLGRELFTVNFDSGEKLILFAHEIETVSDGLAA*
Ga0066674_101268753F037379GGAGMIWEPRHPRRWLLAVGACAAVFLMGKSRPAAAASAEDCRAFHQECTEARAAGYRDVGICNVERLECPAGPDAGVPKRSHEARDADGHDPESAVGERSIGP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.