| Basic Information | |
|---|---|
| Taxon OID | 3300005145 Open in IMG/M |
| Scaffold ID | Ga0068713_1000632 Open in IMG/M |
| Source Dataset Name | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 61204 |
| Total Scaffold Genes | 58 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 48 (82.76%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New Jersey, Arthur Kill intertidal strait | |||||||
| Coordinates | Lat. (o) | 40.58 | Long. (o) | -74.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063816 | Metagenome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068713_10006324 | F063816 | GAG | MESVELKLRLIDNGEFVVSYTKKIVEMLGEPELSLEVKAGQISEDVSRLIESLGYQIAARKAMDDWIQLKAVKPSK* |
| ⦗Top⦘ |