NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072934_10295548

Scaffold Ga0072934_10295548


Overview

Basic Information
Taxon OID3300005101 Open in IMG/M
Scaffold IDGa0072934_10295548 Open in IMG/M
Source Dataset NameMicrobial Community from Halfdan Field MHBA7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameNorth Sea, Denmark
CoordinatesLat. (o)55.49Long. (o)7.42Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025408Metagenome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0072934_102955481F025408GAGGMGEEGGVVEIGNVECFEEEVCERMRVDGDVQQWLVENLNDWLDGLHDRMKSWIEKMEKAKTVEDIMRAKKSMLLDYMDSMPLGPDQCYFCLLYRGESCEACEYSMVHGICNDKDSDYGEIGNLRDKLRQVLEERYYRDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.