| Basic Information | |
|---|---|
| Taxon OID | 3300005099 Open in IMG/M |
| Scaffold ID | Ga0072682_101216 Open in IMG/M |
| Source Dataset Name | Hydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 10, 8-11cmbsf |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9194 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Sediment In Guaymas |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymas Basin | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033275 | Metagenome | 177 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072682_1012165 | F033275 | GAG | VLLPRRLGVNVQAEQAKGASAANVDGGSEATTACFSRLLLLSLALQRRAGGFFSASSAPLR* |
| ⦗Top⦘ |