NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072505_1339994

Scaffold Ga0072505_1339994


Overview

Basic Information
Taxon OID3300005097 Open in IMG/M
Scaffold IDGa0072505_1339994 Open in IMG/M
Source Dataset NameMiSeq S massa metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, San Diego
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)715
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location
Location NameGuam
CoordinatesLat. (o)13.4388546Long. (o)144.8224773Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020857Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0072505_13399941F020857GAGVLFLQDYCALQELLMKMNFTIAVAPPFVHPMTSLPATPTHSVWKYGLFSEPTRQREVAKYGTLKRCESRSFSGDIESLEPSKL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.