| Basic Information | |
|---|---|
| Taxon OID | 3300005097 Open in IMG/M |
| Scaffold ID | Ga0072505_1091766 Open in IMG/M |
| Source Dataset Name | MiSeq S massa metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, San Diego |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1525 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guam | |||||||
| Coordinates | Lat. (o) | 13.4388546 | Long. (o) | 144.8224773 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098755 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072505_10917663 | F098755 | N/A | RQRRRDDARLTESGNTRSEQLLVVHTESLTDREWLPGELLGRSEGQRSGWFLDKKYLTCL |
| ⦗Top⦘ |