Basic Information | |
---|---|
Taxon OID | 3300005097 Open in IMG/M |
Scaffold ID | Ga0072505_1041348 Open in IMG/M |
Source Dataset Name | MiSeq S massa metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, San Diego |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 879 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guam | |||||||
Coordinates | Lat. (o) | 13.4388546 | Long. (o) | 144.8224773 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024258 | Metagenome / Metatranscriptome | 206 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072505_10413481 | F024258 | GAG | MRLHVNYACAIGTRLNLDLLCVAQNGVVLELCRIAASQNCHSCQFANKRAERGYYDESDIILCVK* |
⦗Top⦘ |