Scaffold Ga0072505_1002974

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072505_1002974

Scaffold Ga0072505_1002974

Overview

Basic Information
Taxon OID	3300005097 Open in IMG/M
Scaffold ID	Ga0072505_1002974 Open in IMG/M
Source Dataset Name	MiSeq S massa metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, San Diego
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1762
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location
Location Name	Guam
Coordinates	Lat. (^o)	13.4388546	Long. (^o)	144.8224773	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023046	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072505_10029741	F023046	N/A	QSYLVGPPFPEFEARFSATAGWRFSRDLTRRLLIGGVIRVTYLLSMAEITYGSSFEPNSPREQKLGYVEEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.