Scaffold Ga0072501_1138916

Overview

Basic Information

• Taxon OID: 3300005094
• Scaffold ID: Ga0072501_1138916
• Source Dataset Name: Ion Torrent S massa
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Salk Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 547
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → unclassified Microcystis → Microcystis sp. T1-4 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location

• Location Name: Guam
• Coordinates
  • Lat. (^o): 13.4388546
  • Long. (^o): 144.8224773

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083784	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072501_11389161	F083784	N/A	LSIHAGMDFNDTRLNFTVGAGTMVVTADIPIVDDEINEAEEEFVVNLEVPSDTTNSVEFTTQVAVCRIPASDRKCSTEWLHGLN*