Basic Information | |
---|---|
Taxon OID | 3300005094 Open in IMG/M |
Scaffold ID | Ga0072501_1137246 Open in IMG/M |
Source Dataset Name | Ion Torrent S massa |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Salk Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 940 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guam | |||||||
Coordinates | Lat. (o) | 13.4388546 | Long. (o) | 144.8224773 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023046 | Metagenome / Metatranscriptome | 211 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072501_11372461 | F023046 | N/A | PEFKARFSAMTGWHFSRDLTRRLLLVGVVTVMYLLSMAEITPGSSSEPNNLTEQKLGYV* |
⦗Top⦘ |