| Basic Information | |
|---|---|
| Taxon OID | 3300005094 Open in IMG/M |
| Scaffold ID | Ga0072501_1022419 Open in IMG/M |
| Source Dataset Name | Ion Torrent S massa |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Salk Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1265 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guam | |||||||
| Coordinates | Lat. (o) | 13.4388546 | Long. (o) | 144.8224773 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013612 | Metagenome / Metatranscriptome | 269 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072501_10224193 | F013612 | GAG | MMPLPSTSLELRFCVSRKGGTGGVGWVHPKDANSMAASGLVFRSDLVGTSGAISILFGINGVRNKRSHLVGPPFPEFKACFSATAGWHFSRDLTRYLLIG |
| ⦗Top⦘ |