| Basic Information | |
|---|---|
| Taxon OID | 3300005086 Open in IMG/M |
| Scaffold ID | Ga0072334_10790620 Open in IMG/M |
| Source Dataset Name | Microbial Community from Halfdan Field MHDA3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea, Denmark | |||||||
| Coordinates | Lat. (o) | 55.49 | Long. (o) | 7.42 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036998 | Metagenome | 168 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072334_107906201 | F036998 | N/A | WNDVGAQEENVTGYNVFVKYGRKSKISCDASATAGSTITITYTLGLPAAHAMIVAIKPDGALDIVAPEGTLEAGEGKTVTYTVSSTGTYQFFIADSRVLVEGDSAPQNYQLITKWTPDYETGTAKAAECVVS* |
| ⦗Top⦘ |