Scaffold Ga0072334_10287693

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072334_10287693

Scaffold Ga0072334_10287693

Overview

Basic Information
Taxon OID	3300005086 Open in IMG/M
Scaffold ID	Ga0072334_10287693 Open in IMG/M
Source Dataset Name	Microbial Community from Halfdan Field MHDA3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	893
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	North Sea, Denmark
Coordinates	Lat. (^o)	55.49	Long. (^o)	7.42	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026152	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072334_102876931	F026152	AGGAGG	MKKKLEKTKKIYNTPKFWTAKAWAEHMLHISGFTDIKEVKSVQSNTRRKVPRKSNKSKQSSKATV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.