Scaffold Ga0068305_10827624

Overview

Basic Information

• Taxon OID: 3300005083
• Scaffold ID: Ga0068305_10827624
• Source Dataset Name: Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 779
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Darwiniensis Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: University of Queensland, Australia
• Coordinates
  • Lat. (^o): -27.494746
  • Long. (^o): 153.011858

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033480	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068305_108276241	F033480	GGA	LLEFFWLLFLNKNSLLEEFFTGINIPFNCEFLVAQPDGHVVILTEVYRVRPTLPLQTYRFGNWTPDGGLTWPSQGFYHRRNNLQGHTIRATRVNVSRILSVYVKVKVVPKQ*