Scaffold Ga0068305_10000408

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068305_10000408

Scaffold Ga0068305_10000408

Overview

Basic Information
Taxon OID	3300005083 Open in IMG/M
Scaffold ID	Ga0068305_10000408 Open in IMG/M
Source Dataset Name	Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	43536
Total Scaffold Genes	53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	50 (94.34%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Darwiniensis Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location Name	University of Queensland, Australia
Coordinates	Lat. (^o)	-27.494746	Long. (^o)	153.011858	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068305_1000040811	F036964	GAGG	MANHLKILFPALMVTGALGSLITNIAAKGDWRQSLQWLGASLLYTALLFRNQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.