Scaffold Ga0072336_10488153

Overview

Basic Information

• Taxon OID: 3300005082
• Scaffold ID: Ga0072336_10488153
• Source Dataset Name: Microbial Community from Halfdan Field MHDA9
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: North Sea, Denmark
• Coordinates
  • Lat. (^o): 55.49
  • Long. (^o): 7.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053264	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072336_104881531	F053264	N/A	TNRLKLVGSPSVEQLQNGRYKLTVTCSTMNSREDWYSANKARIFPDFGSLQSAEMSIDGLAPRTGEAYADMRLTQVESGNRSNRDGGDYIVVLTYETLGSAFVQVKDDDTDYELNGLRRVTRTSIAEAGTDYDKTVGTSFIDHQIDAETAVRCFLASYAIDDTDSF