Scaffold Ga0070770_10176676

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0070770_10176676

Scaffold Ga0070770_10176676

Overview

Basic Information
Taxon OID	3300005078 Open in IMG/M
Scaffold ID	Ga0070770_10176676 Open in IMG/M
Source Dataset Name	Microbial Community from Halfdan Field MHBA5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2342
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	North Sea, Denmark
Coordinates	Lat. (^o)	55.49	Long. (^o)	7.42	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002151	Metagenome / Metatranscriptome	589	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070770_101766763	F002151	GGA	MEYVNFIALGCSIAAFALSLIACARVGKFVRATADTDWETLANLTGDIAALKRTCQTLNNRLNGMNKATVPQDQIIQQMLEHQNVEQIRRGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.