Scaffold Ga0071116_1222068

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071116_1222068

Scaffold Ga0071116_1222068

Overview

Basic Information
Taxon OID	3300005077 Open in IMG/M
Scaffold ID	Ga0071116_1222068 Open in IMG/M
Source Dataset Name	Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	668
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida

Source Dataset Sampling Location
Location Name	North Port, Florida
Coordinates	Lat. (^o)	27.074722	Long. (^o)	-82.233333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030410	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071116_12220681	F030410	N/A	DHKRVTDIEQYMKVGDIVKSFDFPGIDNCYMVGKVVGIQYDGSFRAEFIKRVWQGSEDRKFKTDYFTAPLNGEHFLDTPDFQRVQVVG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.