Basic Information | |
---|---|
Taxon OID | 3300005077 Open in IMG/M |
Scaffold ID | Ga0071116_1080611 Open in IMG/M |
Source Dataset Name | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1799 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Port, Florida | |||||||
Coordinates | Lat. (o) | 27.074722 | Long. (o) | -82.233333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016800 | Metagenome / Metatranscriptome | 244 | Y |
F048261 | Metagenome / Metatranscriptome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071116_10806112 | F016800 | AGGA | MLDAFTDYPIPSYGDIEGEKAPIRRAKILTYDRNKYCDVLVYQVDEDGDLRGTVVNFKCFYLYKNEARLDDGNPFTYEELETLPWTKVSSPHSI* |
Ga0071116_10806114 | F048261 | GGTGG | VFESNQGDATMTKPLNCKLDVSKIQTLEDVRNVFECMCLSSNASEEHEQYELLKEYFTIPYETPEIKLVLPRKSLEEISQEFDEKIDKQVEDVKYKFEQLKYRQEYQFSKKITQIIEDFEYAKKTGAFPLKLTLGLDYSKLTATGSNITSNFVIKEGGKEVGYYTFGNGYLKYYMNKKPNFVVRFCMDKLLNFRWIDVK* |
⦗Top⦘ |