Scaffold Ga0071116_1030540

Overview

Basic Information

• Taxon OID: 3300005077
• Scaffold ID: Ga0071116_1030540
• Source Dataset Name: Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3776
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → unclassified Acholeplasmataceae → Acholeplasmataceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida

Source Dataset Sampling Location

• Location Name: North Port, Florida
• Coordinates
  • Lat. (^o): 27.074722
  • Long. (^o): -82.233333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018909	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071116_10305406	F018909	AGGAGG	MNWVKIAIGAVVAISVVPMIATTVADLTATGGALEDTIAGTLLDLSPLVFVAGILGYLFLRTGKRE*