NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071116_1004948

Scaffold Ga0071116_1004948


Overview

Basic Information
Taxon OID3300005077 Open in IMG/M
Scaffold IDGa0071116_1004948 Open in IMG/M
Source Dataset NameWater filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12944
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida

Source Dataset Sampling Location
Location NameNorth Port, Florida
CoordinatesLat. (o)27.074722Long. (o)-82.233333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080208Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0071116_100494813F080208GGAGMQAEEFINVINECEVLRDDIDDIRGRVPLTRTEGTKLNQAVSCVDKAKSILSGLFPAIQSLSEDVREELQGELGETD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.