Scaffold Ga0070431_1273351

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0070431_1273351

Scaffold Ga0070431_1273351

Overview

Basic Information
Taxon OID	3300005074 Open in IMG/M
Scaffold ID	Ga0070431_1273351 Open in IMG/M
Source Dataset Name	Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Utah
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	522
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location
Location Name	Guam
Coordinates	Lat. (^o)	13.4388546	Long. (^o)	144.8224773	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087891	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070431_12733511	F087891	N/A	MTDKNYYIGLSDISFYLTDDDGNIKTDKNGNEIIYRLKDGIRYKPLEYITEGIELDMIEKI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.