Scaffold Ga0070431_1161698

Overview

Basic Information

• Taxon OID: 3300005074
• Scaffold ID: Ga0070431_1161698
• Source Dataset Name: Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Utah
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 824
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location

• Location Name: Guam
• Coordinates
  • Lat. (^o): 13.4388546
  • Long. (^o): 144.8224773

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067211	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070431_11616981	F067211	N/A	RTMSFLEPVIASLLGAAVTALAVFLKKNMTAVALLKYGPLVQKAYDIIDPVLDKNLSNWDGSKVDRAFELAVESVADGELSAAEIKKLAVHMAQSWLPGAAAEKVRLLEQNGMPLEQRKAAEDITAKVNTAS*