Scaffold Ga0070431_1084590

Overview

Basic Information

• Taxon OID: 3300005074
• Scaffold ID: Ga0070431_1084590
• Source Dataset Name: Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Utah
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1423
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location

• Location Name: Guam
• Coordinates
  • Lat. (^o): 13.4388546
  • Long. (^o): 144.8224773

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004734	Metagenome	426	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070431_10845902	F004734	GGAG	MIKYFTFMVLTYFVQGEQVTHNILFPSYDACSHNKTAMYDIMIPHQDDVHIYCKGTKFASNELVKPMPRP*