NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070431_1026258

Scaffold Ga0070431_1026258


Overview

Basic Information
Taxon OID3300005074 Open in IMG/M
Scaffold IDGa0070431_1026258 Open in IMG/M
Source Dataset NameMarine benthic sponge Stylissa massa associated microbial communities from Guam, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Utah
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3250
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location
Location NameGuam
CoordinatesLat. (o)13.4388546Long. (o)144.8224773Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038110Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0070431_10262588F038110GAGMSKVDGPESLAISNRDVSYKLMNLKIILLLIHCLVDMPTSKAWLSYLVMAERYRTVRVVVSEDR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.