Scaffold Ga0070431_1009916

Overview

Basic Information

• Taxon OID: 3300005074
• Scaffold ID: Ga0070431_1009916
• Source Dataset Name: Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Utah
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5521
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam

Source Dataset Sampling Location

• Location Name: Guam
• Coordinates
  • Lat. (^o): 13.4388546
  • Long. (^o): 144.8224773

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020857	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070431_10099166	F020857	GAGG	VLFLQDYYALQELLIKMNFTLAVATPFVYPMTSLPATLTHSVQKYGFLSEPTWRRQVAKYGNLKRCESLSFSGDIETLEPSKF*