| Basic Information | |
|---|---|
| Taxon OID | 3300005073 Open in IMG/M |
| Scaffold ID | Ga0071347_1012038 Open in IMG/M |
| Source Dataset Name | Cellulose enrichment metagenome from thermal spring in Terrace, British Columbia, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Leibniz Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2315 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Sediment → Cellulose Enrichment Metagenome From Thermal Spring In Terrace, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Terrace, B.C. Canada | |||||||
| Coordinates | Lat. (o) | 54.358506 | Long. (o) | -128.541159 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102093 | Metagenome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071347_10120383 | F102093 | N/A | VPAKENRKIMKHGSSGVIAIPKPYRDYHNLTPGNTVTILYDSLLLIIPKTHENLLQEKAELIDKLLGQTLMEEPK* |
| ⦗Top⦘ |