NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071347_1007141

Scaffold Ga0071347_1007141


Overview

Basic Information
Taxon OID3300005073 Open in IMG/M
Scaffold IDGa0071347_1007141 Open in IMG/M
Source Dataset NameCellulose enrichment metagenome from thermal spring in Terrace, British Columbia, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLeibniz Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3428
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Sediment → Cellulose Enrichment Metagenome From Thermal Spring In Terrace, British Columbia, Canada

Source Dataset Sampling Location
Location NameTerrace, B.C. Canada
CoordinatesLat. (o)54.358506Long. (o)-128.541159Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069685Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0071347_10071413F069685GAGMSEPPTENVEALKARIAELEAENEKLKAAMAEATKTLAAYVEKEKEATIKSILEKANLSEDELKKLDLAQLKLVQKSIDSVKGTVKNIRSAGAGNTEDSGLTVGCLYHKEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.