Scaffold Ga0068302_10006356

Overview

Basic Information

• Taxon OID: 3300005071
• Scaffold ID: Ga0068302_10006356
• Source Dataset Name: Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 981
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Termopsidae → Termopsinae → Termopsini → Zootermopsis → Zootermopsis nevadensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Porotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: Mount Glorious, Queensland, Australia
• Coordinates
  • Lat. (^o): -27.330504
  • Long. (^o): 152.763993

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063804	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068302_100063561	F063804	N/A	IMDYACPIWRSAAHTHVRKLQVLQSKCLRIATNAPWYVSDRQIHDDLGIPFFADHIGALTESFDSKLADAGNPLVRQLGRHLCQPRAG*