NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071350_1198123

Scaffold Ga0071350_1198123


Overview

Basic Information
Taxon OID3300005069 Open in IMG/M
Scaffold IDGa0071350_1198123 Open in IMG/M
Source Dataset NameMetagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1229
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.611214Long. (o)163.119356Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025270Metagenome / Metatranscriptome202N
F083683Metagenome / Metatranscriptome112N
F104441Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0071350_11981232F025270AGGMNQETIENGNTLRSLRVRQATKASKFKLKRQWQKVAAETLAKLNDVKTNEINTSEHNIAVFNEIFIKIQELRRLDPEREINQYALAQAVITKYNCSLCLPTDDSDYEYEPTSS*
Ga0071350_11981233F104441N/AMETSTSTDNPEKKQKIEKQKMLVADLFSTLNLVFTQTKLGIERSNLLLRAIHQFKTDILKIDPYWKLISWPHITIGRIFCSIEVIEIL*
Ga0071350_11981234F083683N/ATINFRHLQRLHELMKELKSLDPEYPVTDIVQTSELNILKNLDRIQTTRSWDDAGNKLVYINIQGEISKIRKFHPDWDVDLDCIYRYHICRCLRCKSEGFLCTQHVLDSSNEISSPQSDTSDEGKPFPALNSKQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.