Basic Information | |
---|---|
Taxon OID | 3300005069 Open in IMG/M |
Scaffold ID | Ga0071350_1142139 Open in IMG/M |
Source Dataset Name | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 784 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Fryxell, Antarctica | |||||||
Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002383 | Metagenome / Metatranscriptome | 565 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071350_11421391 | F002383 | N/A | SFYYISMEQRAFENVNNCLNTNIYSYLDTSGGQSSNPYVNAVHFFNTRVKYISVAA* |
⦗Top⦘ |