NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071350_1073923

Scaffold Ga0071350_1073923


Overview

Basic Information
Taxon OID3300005069 Open in IMG/M
Scaffold IDGa0071350_1073923 Open in IMG/M
Source Dataset NameMetagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1013
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.611214Long. (o)163.119356Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019439Metagenome / Metatranscriptome229Y
F022148Metagenome / Metatranscriptome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0071350_10739231F019439N/AMTSGCRTLESVPEKNIIEINTVYPPNSNHTQCYNMPSGHKFAFKISTEIPQLNMTMNNTVVASVLEEYYHYAYLFRDELEEEVRKMDFAFNKRTQILLATIIKENNRKLLRHLAPYIVMLIIIGKIFGYKAVLLVIFATNLIQQTKAEKPTT
Ga0071350_10739232F022148GAGVVPKVEAPERSGFTVGALGAEVCFGRVPEVDGVGDECELLAVVELVEPELAGVVVVGAGAGGAAGGTVLTNVFAGPKSCNLGTVVQLYWNSGTVSSSPVRNLYMSEVSNVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.