NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071350_1003340

Scaffold Ga0071350_1003340


Overview

Basic Information
Taxon OID3300005069 Open in IMG/M
Scaffold IDGa0071350_1003340 Open in IMG/M
Source Dataset NameMetagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4438
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.611214Long. (o)163.119356Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010598Metagenome / Metatranscriptome301N
F011064Metagenome / Metatranscriptome295N
F017099Metagenome / Metatranscriptome242N

Sequences

Protein IDFamilyRBSSequence
Ga0071350_10033403F017099N/AMEFIEHIIVGFWKNFDSILQTKEPTRNELFYALAALQHDILQCYRKILDQVDNPSQVLDLRDEASAILSQIIRCHRAKGVQFQLYYDTPKPWSKPSHKKLIDFSMALNLIQMSHKRIDDKPGNELVASQKVDDNFIRLLSEILRFILAWTVPLTLREIALYKYFKLDPVGYEHDKNLKIGLFDSPPVVECIENRVSIRMEELTRQGENVLVSTPKPEDSNRAQTLVEEKEKLEFLSNWFIWE*
Ga0071350_10033404F011064N/AMGIKILYFQKMARESVLDNFWQEFAAIEWASDMSLGDLFDVSLWTHKLCASLCDLHMISQAPRISQYDLNTVGANILGFVFNIYRCKMDQLNLTLEIDYHWVNFETQRDSEILKSIKRLQEILIANKIMSNEGSDRLRQSYTLCRYRADIQSDQDLGYELSCVLQFIAIKAKK*
Ga0071350_10033405F010598N/AMTTLTTPRRVIIFGGSNARRIVPFLLELTKGKGIRIEDRTVSGHSLEDLRNFPKSTEVREKDFIFVLSGGNDIFEKHIKIHRRFGKVHKICLTKCVPNPLSSIQRLYENLKEKLKDLKCHKYVITNPYRHLYCCPEHYDVTYYGNILRCQNAANSCLIKTLKAAAAILKVEKIIGLSCKEKRRGYPDHMIDSVHFKQRFYLRAAQSLCKIVSEKSSSC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.