Scaffold Ga0071350_1000245

Overview

Basic Information

• Taxon OID: 3300005069
• Scaffold ID: Ga0071350_1000245
• Source Dataset Name: Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12644
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location

• Location Name: Lake Fryxell, Antarctica
• Coordinates
  • Lat. (^o): -77.611214
  • Long. (^o): 163.119356

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074432	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0071350_10002458	F074432	N/A	MKGVRHVLVPKSAYQIVVFVLGASARIRLYSIGVYCNQIDGGVEMDLVPGMYTLCVCGPYSHVGLRVAPGCTAFFSLHKHFFKPSETFTVVVRSNINNTPLTLRKLCMFEAVYRGFSVEILPLSVKSKLFRPRNINSDIENVLNLPLCVCSDMYYSDTEDENETPSVETNNT*