| Basic Information | |
|---|---|
| Taxon OID | 3300005058 Open in IMG/M |
| Scaffold ID | Ga0071082_105836 Open in IMG/M |
| Source Dataset Name | Co-DHS sludge microbial communities |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 13386 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (58.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Urbana, Illinois, USA | |||||||
| Coordinates | Lat. (o) | 40.114056 | Long. (o) | -88.226756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014031 | Metagenome / Metatranscriptome | 266 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071082_1058361 | F014031 | AGGAGG | MRKQRGRVGLMAAALVGLAVGAAQAQVTTEKSASILVLPKVISDGTRDAVIQITNTSNSMVHAHCFYVNGALTFPDLPPGPLNPPLWTEIDFDIWLTKQQPTHWVVS |
| ⦗Top⦘ |