Scaffold Ga0068511_1065794

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068511_1065794

Scaffold Ga0068511_1065794

Overview

Basic Information
Taxon OID	3300005057 Open in IMG/M
Scaffold ID	Ga0068511_1065794 Open in IMG/M
Source Dataset Name	Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	614
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Eurybiavirus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location Name	East Sea, Korea
Coordinates	Lat. (^o)	37.0	Long. (^o)	131.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004764	Metagenome / Metatranscriptome	424	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068511_10657941	F004764	N/A	ILSAYHVERFTYLRDNEQYQDADAIAQEYICNGEVEDDNYQWLYVNYQFEEAN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.