Scaffold Ga0068511_1022753

Overview

Basic Information

• Taxon OID: 3300005057
• Scaffold ID: Ga0068511_1022753
• Source Dataset Name: Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 922
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location

• Location Name: East Sea, Korea
• Coordinates
  • Lat. (^o): 37.0
  • Long. (^o): 131.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058440	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068511_10227532	F058440	N/A	MKKKKIKFTISNLFWTPETEEEYLSFLNRYTGSEKALVSLAGQIAMNYVLNKINKEFTVTRNES*