Scaffold Ga0071100_1052385

Overview

Basic Information

• Taxon OID: 3300005043
• Scaffold ID: Ga0071100_1052385
• Source Dataset Name: Mid-Atlantic Ridge North Pond Expedition - Sample 1382A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 989
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location

• Location Name: North Pond, Atlantic Ocean
• Coordinates
  • Lat. (^o): 22.78
  • Long. (^o): -46.09
  • Depth (m): 90 to 210

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007607	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071100_10523852	F007607	N/A	EDISMKGDKFHYVQRPSKQRLFATGMNGDEDLGEDIKMHGNPYHYVQKPSKQNLFATGMNGDEDLGEDISMKGDKFHYVQKPAQQILFATGMNGDEDLGEDISMKGDKFHYVQEPSK*