Scaffold Ga0072325_1200079

Overview

Basic Information

• Taxon OID: 3300004972
• Scaffold ID: Ga0072325_1200079
• Source Dataset Name: Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 590
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location

• Location Name: Germany: Weissenstadt
• Coordinates
  • Lat. (^o): 50.13
  • Long. (^o): 11.88

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000272	Metagenome / Metatranscriptome	1408	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072325_12000791	F000272	AGGAGG	MSQSVLDRTAEHIGESAHQASRATSAVADTIKDGVGVVRRVAKQGGDVAEEFLVDTTQRIQRHPVLTVATTFAVGFAAGALIGWMIKRK*