NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072327_1016180

Scaffold Ga0072327_1016180


Overview

Basic Information
Taxon OID3300004969 Open in IMG/M
Scaffold IDGa0072327_1016180 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)613
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008605Metagenome / Metatranscriptome330N

Sequences

Protein IDFamilyRBSSequence
Ga0072327_10161801F008605N/AGTVTSISDHMIRGPGFNVTIFSIDWERPTVNRAWEFGNPESYNFVQGFFGGACGSPSGGFVSGSSRSGFVCNNMVGAEIDLGAYNNGSLKDWIGDEPSASLATSIDSSGLFQNQFENNVTLVGGGFPILNPAGNLFDANFTWFGSEVRRPGFVGGILGANGPTSAGSPFLAVPAYGSVHNVNGLFNWAHQLEPTAFQPGEYDFG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.