| Basic Information | |
|---|---|
| Taxon OID | 3300004951 Open in IMG/M |
| Scaffold ID | Ga0068513_1001905 Open in IMG/M |
| Source Dataset Name | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2190 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East Sea, Korea | |||||||
| Coordinates | Lat. (o) | 37.0 | Long. (o) | 131.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020468 | Metagenome / Metatranscriptome | 224 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068513_10019052 | F020468 | AGGGGG | MPLVKKDLTLAAGATSDQILAGTTYEYVGPGTRLVVAATAGDGSGGIAADDSTGVQMNFNVNNAEFARDVAVSPAISGEAFGWKGNYVLNDMVTTAAERNRPIVTFTNTSGATRNVSVAIFIGG* |
| ⦗Top⦘ |