NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068513_1001391

Scaffold Ga0068513_1001391


Overview

Basic Information
Taxon OID3300004951 Open in IMG/M
Scaffold IDGa0068513_1001391 Open in IMG/M
Source Dataset NameMarine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2473
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameEast Sea, Korea
CoordinatesLat. (o)37.0Long. (o)131.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000713Metagenome / Metatranscriptome925Y
F008886Metagenome / Metatranscriptome326Y

Sequences

Protein IDFamilyRBSSequence
Ga0068513_10013911F000713AGGAGMPLVKKRITVTAGNTSEQILQGTTYEYVDPGTRIVVASADATGTYSGNVVMNFTVNNSEFAKDAQVSELVTGQPFGWNNTGYVMNDTVTTGSVRNRPVI
Ga0068513_10013915F008886N/AQPFGWNNTGYVMNDTVTTGSVRNRPVITFTNNDSNSATIDVAVFIA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.